Skip to product information
1 of 1

CDKN1B, Human (His)

CDKN1B, Human (His)

Size

SKU:QM-0192974-01

£232.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The CDKN1B protein is a key cell cycle regulator that inhibits CDK2 when bound to cyclin A, thereby inhibiting G1 phase progression. It exhibits significant inhibitory effects on cyclin E- and cyclin A-CDK2 complexes. CDKN1B Protein, Human (His) is the recombinant human-derived CDKN1B protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    1027 (Gene_ID) P46527 (M1-T198) (Accession)

  • Smiles

    MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0192974-01
10 µgQM-0192974-01
£232.25/ea
£0.00
£232.25/ea £0.00
50 µgQM-0192974-02
50 µgQM-0192974-02
£599.18/ea
£0.00
£599.18/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CDKN1B, Human (His)

CDKN1B, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.