Skip to product information
1 of 1

CDKN2A, Human

CDKN2A, Human

Size

SKU:QM-0204490-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CDKN2A Protein, a potent negative regulator of cell proliferation, forms strong interactions with CDK4 and CDK6, hindering their association with cyclins D and retinoblastoma protein phosphorylation. Acting in a heterodimeric manner, predominantly with CDK6, CDKN2A inhibits cyclin D-CDK4 kinase activity and interacts with ISCO2, contributing to its cell cycle regulatory role. CDKN2A Protein, Human is the recombinant human-derived CDKN2A protein, expressed by E. coli , with tag free.

  • Molecular Formula

    1029 (Gene_ID) P42771 (E2-D156) (Accession)

  • Smiles

    EPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

  • Purity

    99

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0204490-01
2 µgQM-0204490-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0204490-02
10 µgQM-0204490-02
£147.63/ea
£0.00
£147.63/ea £0.00
50 µgQM-0204490-03
50 µgQM-0204490-03
£409.64/ea
£0.00
£409.64/ea £0.00
100 µgQM-0204490-04
100 µgQM-0204490-04
£664.79/ea
£0.00
£664.79/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CDKN2A, Human

CDKN2A, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.