Skip to product information
1 of 1

CDKN2C, Human (His)

CDKN2C, Human (His)

Size

SKU:QM-0188564-01

£227.39 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The CDKN2C protein (also known as p18) interacts strongly with CDK6 and weakly with CDK4. Its functional effects inhibit cell growth and proliferation and are significantly related to the presence of endogenous retinoblastoma protein RB. CDKN2C Protein, Human (His) is the recombinant human-derived CDKN2C protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    1031 (Gene_ID) P42773 (M1-Q168) (Accession)

  • Smiles

    MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0188564-01
10 µgQM-0188564-01
£227.39/ea
£0.00
£227.39/ea £0.00
50 µgQM-0188564-02
50 µgQM-0188564-02
£548.15/ea
£0.00
£548.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CDKN2C, Human (His)

CDKN2C, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.