Collection: Cancer Research Compounds
Browse QuantiMol's comprehensive range of cancer research compounds for oncology, cell signalling, apoptosis, cell cycle regulation, DNA damage and repair, angiogenesis, and tumour biology studies. This collection includes anticancer research molecules, kinase inhibitors, epigenetic modulators, PARP inhibitors, HDAC inhibitors, PROTAC degraders, and pathway-specific tool compounds targeting key oncogenic drivers such as PI3K, AKT, mTOR, MAPK, JAK/STAT, EGFR, VEGFR, and BRAF.
Every compound in this collection is supplied by QuantiMol to the highest purity standards, supporting reproducible in vitro and in vivo cancer biology research. Whether you are investigating apoptosis, ferroptosis, autophagy, or metastatic signalling cascades, QuantiMol provides the chemically defined, well-characterised tool compounds needed to drive your oncology research forward with confidence.
-
TOPOI/PARP-1-IN-2
SKU: QM-0120047 | Size: 1 Each Price on request -
Tiparp Rat Pre-designed siRNA Set A
SKU: QM-0119282 | Size: 1 Set£426.65 GBP -
Topo II/HDAC-IN-2 [CAS 2922269-24-5]
CAS: 2922269-24-5 | SKU: QM-0068215 | Size: 1 Each Price on request -
Tolrestat (Standard) [CAS 82964-04-3]
CAS: 82964-04-3 | SKU: QM-0116763-01 | Size: 5 mg£482.54 GBP -
VEGFR-1, Human (HEK293, His)
SKU: QM-0111035-01 | Size: 10 µg£142.25 GBP -
Topiroxostat (Standard) [CAS 577778-58-6]
CAS: 577778-58-6 | SKU: QM-0110321-01 | Size: 5 mg£127.38 GBP -
Topoisomerase II/EGFR-IN-1
SKU: QM-0072920 | Size: 1 Each Price on request -
Tumor targeted pro-apoptotic peptide [CAS 1926163-30-5]
CAS: 1926163-30-5 | SKU: QM-0106903 | Size: 1 Each Price on request -
Thailanstatin A cyclohexane diamine (formic)
SKU: QM-0105869 | Size: 1 mg£1,179.95 GBP -
Vat-Cit-PAB-Monomethyl Dolastatin 10 [CAS 1415329-13-3]
CAS: 1415329-13-3 | SKU: QM-0000394-01 | Size: 1 mg£279.63 GBP -
TOPOI/PARP-1-IN-1 [CAS 2948352-16-5]
CAS: 2948352-16-5 | SKU: QM-0105582 | Size: 1 Each Price on request -
Top/HDAC-IN-3 [CAS 3059615-90-3]
CAS: 3059615-90-3 | SKU: QM-0104738 | Size: 1 Each Price on request -
VEGFR-2, Human (1355a.a, sf9, GST)
SKU: QM-0102023 | Size: 1 Each Price on request -
Topo II/HDAC-IN-1 [CAS 2922269-18-7]
CAS: 2922269-18-7 | SKU: QM-0068214 | Size: 1 Each Price on request -
VEGF165, zebrafish (sf9)
SKU: QM-0113305 | Size: Inquire Price on request -
VEGFR-1, Human (328a.a, HEK293, Fc)
SKU: QM-0097219 | Size: 1 Each Price on request -
Tubulin/HDAC-IN-1 [CAS 2413587-26-3]
CAS: 2413587-26-3 | SKU: QM-0069063 | Size: 1 Each Price on request -
Tubulin/PARP-IN-1
SKU: QM-0072756 | Size: 1 Each Price on request -
TLR4/NF-κB/MAPK-IN-1 [CAS 2767567-26-8]
CAS: 2767567-26-8 | SKU: QM-0065134 | Size: 1 Each Price on request -
TIPARP Human Pre-designed siRNA Set A
SKU: QM-0090066 | Size: 1 Set£426.65 GBP -
Tyrosine Protein Kinase JAK 2 (Phospho-Tyr8, 9) [CAS 247171-44-4]
CAS: 247171-44-4 | SKU: QM-0001273 | Size: 1 Each Price on request -
Type A Allatostatin III [CAS 123209-96-1]
CAS: 123209-96-1 | SKU: QM-0089147 | Size: 1 Each Price on request -
Tie2 kinase inhibitor 3 [CAS 870225-11-9]
CAS: 870225-11-9 | SKU: QM-0087613 | Size: 1 Each Price on request -
VEGFR-2, Cynomolgus (Biotinylated, HEK293, His, Avi)
SKU: QM-0087142 | Size: 1 Each Price on request -
Tubulin/PARP-IN-2
SKU: QM-0072860 | Size: 1 Each Price on request -
Thrombostatin cont-1 [CAS 929555-19-1]
CAS: 929555-19-1 | SKU: QM-0085763 | Size: 1 Each Price on request -
Thailanstatin C [CAS 1426953-24-3]
CAS: 1426953-24-3 | SKU: QM-0063644 | Size: 1 Each Price on request -
Tyr-Somatostatin-28 [CAS 86649-84-5]
CAS: 86649-84-5 | SKU: QM-0084554 | Size: 1 Each Price on request -
Tubastatin A (TFA) [CAS 1239262-52-2]
CAS: 1239262-52-2 | SKU: QM-0061979 | Size: 1 Each Price on request -
Tubulin/HDAC-IN-2
SKU: QM-0071874 | Size: 1 Each Price on request -
STAT6-IN-7 [CAS 3033743-58-4]
CAS: 3033743-58-4 | SKU: QM-0050536 | Size: 1 Each Price on request -
STAT6-IN-8 [CAS 3033741-50-0]
CAS: 3033741-50-0 | SKU: QM-0050535 | Size: 1 Each Price on request -
Stat5a Rat Pre-designed siRNA Set A
SKU: QM-0043495 | Size: 1 Set£426.65 GBP -
Stath Rat Pre-designed siRNA Set A
SKU: QM-0042395 | Size: 1 Set£426.65 GBP -
Stat4 Rat Pre-designed siRNA Set A
SKU: QM-0041525 | Size: 1 Set£426.65 GBP -
Stat5a Mouse Pre-designed siRNA Set A
SKU: QM-0037010 | Size: 1 Set£426.65 GBP -
Stat4 Mouse Pre-designed siRNA Set A
SKU: QM-0035082 | Size: 1 Set£426.65 GBP -
STAT6 ligand-2
SKU: QM-0016378 | Size: 1 Each Price on request -
STAT3-IN-49
SKU: QM-0016040 | Size: 1 Each Price on request -
Tenivastatin (calcium) [CAS 151006-18-7]
CAS: 151006-18-7 | SKU: QM-0015106 | Size: 1 Each Price on request -
STAT3-IN-47 [CAS 2787548-58-5]
CAS: 2787548-58-5 | SKU: QM-0015015 | Size: 1 Each Price on request -
STAT3-IN-52 [CAS 1556861-34-7]
CAS: 1556861-34-7 | SKU: QM-0014908-01 | Size: 5 mg£285.71 GBP -
STAT6 degrader-3 [CAS 3077464-19-5]
CAS: 3077464-19-5 | SKU: QM-0014525-01 | Size: 1 mg£678.15 GBP -
Suvigletistat [CAS 2410912-75-1]
CAS: 2410912-75-1 | SKU: QM-0014390-01 | Size: 5 mg£1,368.28 GBP -
STAT6-IN-10 [CAS 3092076-19-9]
CAS: 3092076-19-9 | SKU: QM-0014274 | Size: 1 Each Price on request -
STAT6 ligand-1
SKU: QM-0014202 | Size: 1 Each Price on request -
STAT3-IN-46
SKU: QM-0013412 | Size: 1 Each Price on request -
STAT6-IN-9 [CAS 3092076-15-5]
CAS: 3092076-15-5 | SKU: QM-0013317 | Size: 1 Each Price on request -
STAT3/NF-κB-IN-1
SKU: QM-0012956 | Size: 1 Each Price on request -
STAT3-IN-44
SKU: QM-0012762 | Size: 1 Each Price on request -
STAT3/CAIX-IN-1 [CAS 3053583-60-8]
CAS: 3053583-60-8 | SKU: QM-0012048 | Size: 1 Each Price on request -
STAT3-IN-43 [CAS 2761657-21-8]
CAS: 2761657-21-8 | SKU: QM-0011972 | Size: 1 Each Price on request -
STAT4-IN-1
SKU: QM-0011334-01 | Size: 5 mg£828.82 GBP -
STAT3-IN-40 [CAS 3053241-01-0]
CAS: 3053241-01-0 | SKU: QM-0011123 | Size: 1 Each Price on request -
STAT3-IN-42
SKU: QM-0011083 | Size: 1 Each Price on request -
STAT5-IN-3
SKU: QM-0009637 | Size: 1 Each Price on request -
STAT3-IN-41
SKU: QM-0008680 | Size: 1 Each Price on request -
Stattic (Standard) [CAS 19983-44-9]
CAS: 19983-44-9 | SKU: QM-0006619-01 | Size: 5 mg£111.63 GBP -
Telaglenastat (Standard) [CAS 1439399-58-2]
CAS: 1439399-58-2 | SKU: QM-0004844-01 | Size: 5 mg£238.32 GBP -
Statine (Standard) [CAS 49642-07-1]
CAS: 49642-07-1 | SKU: QM-0002508 | Size: 1 Each Price on request -
Subasumstat [CAS 1858276-04-6]
CAS: 1858276-04-6 | SKU: QM-0137215-01 | Size: 1 mg£135.25 GBP -
Telaglenastat [CAS 1439399-58-2]
CAS: 1439399-58-2 | SKU: QM-0140548-01 | Size: 5 mg£94.75 GBP -
STAT5-IN-2 [CAS 2111834-61-6]
CAS: 2111834-61-6 | SKU: QM-0081781-01 | Size: 5 mg£551.80 GBP -
Telotristat [CAS 1033805-28-5]
CAS: 1033805-28-5 | SKU: QM-0143300-01 | Size: 5 mg£124.00 GBP -
STAT6-IN-3 [CAS 371919-80-1]
CAS: 371919-80-1 | SKU: QM-0077582-01 | Size: 1 mg£865.26 GBP -
Tazemetostat [CAS 1403254-99-8]
CAS: 1403254-99-8 | SKU: QM-0146166-01 | Size: 5 mg£94.75 GBP -
STAT5-IN-1 [CAS 285986-31-4]
CAS: 285986-31-4 | SKU: QM-0081601-01 | Size: 5 mg£94.75 GBP -
Sucunamostat (hydrochloride)
SKU: QM-0144177-01 | Size: 5 mg£890.78 GBP -
Stattic [CAS 19983-44-9]
CAS: 19983-44-9 | SKU: QM-0146214-01 | Size: 5 mg£65.37 GBP -
Tazemetostat de (methyl morpholine) -COOH [CAS 2685873-44-1]
CAS: 2685873-44-1 | SKU: QM-0149222-01 | Size: 5 mg£551.80 GBP -
STAT6-IN-2 [CAS 1355594-85-2]
CAS: 1355594-85-2 | SKU: QM-0151384-01 | Size: 5 mg£325.81 GBP -
STAT6-IN-1 [CAS 1637532-68-3]
CAS: 1637532-68-3 | SKU: QM-0149554-01 | Size: 5 mg£1,013.50 GBP -
STAT3-IN-48 [CAS 1313019-65-6]
CAS: 1313019-65-6 | SKU: QM-0145696-01 | Size: 5 mg£140.88 GBP -
Tazemetostat (Standard) [CAS 1403254-99-8]
CAS: 1403254-99-8 | SKU: QM-0146167-01 | Size: 5 mg£238.32 GBP -
Telotristat ethyl [CAS 1033805-22-9]
CAS: 1033805-22-9 | SKU: QM-0143299-01 | Size: 5 mg£135.25 GBP -
Tazemetostat de (methylene morpholine) -O-C3-O-C-COOH [CAS 2750350-39-9]
CAS: 2750350-39-9 | SKU: QM-0149221-01 | Size: 5 mg£614.98 GBP -
STAT3-SH2 domain inhibitor 1 [CAS 2816059-41-1]
CAS: 2816059-41-1 | SKU: QM-0150575-01 | Size: 5 mg£765.63 GBP -
Tefinostat [CAS 914382-60-8]
CAS: 914382-60-8 | SKU: QM-0112177-01 | Size: 5 mg£414.50 GBP -
Stathmin, Human (His)
SKU: QM-0204675-01 | Size: 5 µg£97.00 GBP -
TAO Kinase inhibitor 1 [CAS 850467-66-2]
CAS: 850467-66-2 | SKU: QM-0137356-01 | Size: 5 mg£118.38 GBP -
Telotristat etiprate [CAS 1137608-69-5]
CAS: 1137608-69-5 | SKU: QM-0143295-01 | Size: 5 mg£115.00 GBP -
STAT6, Human (His)
SKU: QM-0204404-01 | Size: 5 µg£111.63 GBP -
STAT6-IN-5 [CAS 3033742-22-9]
CAS: 3033742-22-9 | SKU: QM-0152565-01 | Size: 1 mg£865.26 GBP -
STAT4, Human (sf9, His)
SKU: QM-0204228-01 | Size: 5 µg£132.13 GBP -
Talabostat (mesylate) [CAS 150080-09-4]
CAS: 150080-09-4 | SKU: QM-0143965-01 | Size: 5 mg£215.24 GBP -
STAT6-IN-4 [CAS 3033742-14-9]
CAS: 3033742-14-9 | SKU: QM-0152564-01 | Size: 1 mg£727.97 GBP -
STAT6, Human (536a.a, His)
SKU: QM-0202715-01 | Size: 5 µg£280.34 GBP -
Statherin, Human (HEK293, Fc)
SKU: QM-0202556-01 | Size: 5 µg£101.75 GBP -
Synstatin (92-119) [CAS 1259384-47-8]
CAS: 1259384-47-8 | SKU: QM-0196417-01 | Size: 1 mg£78.82 GBP -
TAT-Braftide
SKU: QM-0195494-01 | Size: 1 mg£89.13 GBP -
Talabostat isomer mesylate
SKU: QM-0143966-01 | Size: 5 mg£376.83 GBP -
Stathmin, Human (C-His)
SKU: QM-0184589-01 | Size: 10 µg£127.38 GBP -
Statine [CAS 49642-07-1]
CAS: 49642-07-1 | SKU: QM-0081625-01 | Size: 5 mg£188.51 GBP -
TAO Kinase inhibitor 2 [CAS 850467-77-5]
CAS: 850467-77-5 | SKU: QM-0151280-01 | Size: 5 mg£124.00 GBP -
STAT6, Human (sf9, His, Strep)
SKU: QM-0176080-01 | Size: 10 µg£324.07 GBP -
STAT6, Human (Phosphorylated, 536a.a, His)
SKU: QM-0175581-01 | Size: 10 µg£1,181.87 GBP -
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
SKU: QM-0172917-01 | Size: 5 mg£715.82 GBP -
STAT5B, Human (His)
SKU: QM-0172228-01 | Size: 10 µg£241.46 GBP -
Talabostat [CAS 149682-77-9]
CAS: 149682-77-9 | SKU: QM-0000457-01 | Size: 5 mg£215.24 GBP -
STAT5B Human Pre-designed siRNA Set A
SKU: QM-0167628 | Size: 1 Set£426.65 GBP -
Stearyl myristate [CAS 3234-81-9]
CAS: 3234-81-9 | SKU: QM-0135828 | Size: 1 Each Price on request -
STAT6 Human Pre-designed siRNA Set A
SKU: QM-0132904 | Size: 1 Set£426.65 GBP -
TCO-PAL-PARP
SKU: QM-0132692 | Size: 1 Each Price on request -
STAT3/HDAC-IN-2
SKU: QM-0126394 | Size: 1 Each Price on request -
Telaglenastat (hydrochloride) [CAS 1874231-60-3]
CAS: 1874231-60-3 | SKU: QM-0060224 | Size: 1 Each Price on request -
TAT-MEK1 [CAS 566872-16-0]
CAS: 566872-16-0 | SKU: QM-0124321 | Size: 1 Each Price on request -
Stat5b Rat Pre-designed siRNA Set A
SKU: QM-0124224 | Size: 1 Set£426.65 GBP -
STATH Human Pre-designed siRNA Set A
SKU: QM-0122701 | Size: 1 Set£426.65 GBP -
Telotristat (besilate) [CAS 1374745-52-4]
CAS: 1374745-52-4 | SKU: QM-0119808 | Size: 1 Each Price on request -
Tanomastat [CAS 179545-77-8]
CAS: 179545-77-8 | SKU: QM-0060095 | Size: 500 µg£125.13 GBP -
Telotristat (Standard) [CAS 1033805-28-5]
CAS: 1033805-28-5 | SKU: QM-0115948-01 | Size: 5 mg£325.81 GBP -
STAT5A Protein, Human (sf9, His)
SKU: QM-0115614-01 | Size: 100 µg Price on request -
Stat6 Rat Pre-designed siRNA Set A
SKU: QM-0113783 | Size: 1 Set£426.65 GBP -
STAT3/AKT-IN-1
SKU: QM-0111268 | Size: 1 Each Price on request -
SYK/JAK-IN-1 [CAS 2737326-28-0]
CAS: 2737326-28-0 | SKU: QM-0066078 | Size: 1 Each Price on request -
Symplostatin 1 [CAS 212007-18-6]
CAS: 212007-18-6 | SKU: QM-0108890 | Size: 1 Each Price on request -
Sucunamostat [CAS 1802888-04-5]
CAS: 1802888-04-5 | SKU: QM-0061994 | Size: 1 Each Price on request -
Sucunamostat (hydrate)
SKU: QM-0061361 | Size: 1 Each Price on request -
STAT3-IN-7 [CAS 2237955-91-6]
CAS: 2237955-91-6 | SKU: QM-0066046 | Size: 1 Each Price on request -
STE-MEK1 (13) [CAS 566872-15-9]
CAS: 566872-15-9 | SKU: QM-0096254 | Size: 1 Each Price on request