Collection: Cancer Research Compounds
Browse cancer research compounds for oncology, cell signaling, apoptosis, cell cycle, DNA damage, angiogenesis, and tumor biology studies. This collection includes anticancer research molecules, inhibitors, modulators, and pathway compounds.
-
TOPOI/PARP-1-IN-2
SKU: QM-0120047 | Size: 1 Each Price on request -
Tiparp Rat Pre-designed siRNA Set A
SKU: QM-0119282 | Size: 1 SetRegular price £426.65 GBPRegular priceSale price £426.65 GBP -
Topo II/HDAC-IN-2 [CAS 2922269-24-5]
CAS: 2922269-24-5 | SKU: QM-0068215 | Size: 1 Each Price on request -
Tolrestat (Standard) [CAS 82964-04-3]
CAS: 82964-04-3 | SKU: QM-0116763-01 | Size: 5 mgRegular price £482.54 GBPRegular priceSale price £482.54 GBP -
VEGFR-1, Human (HEK293, His)
SKU: QM-0111035-01 | Size: 10 µgRegular price £142.25 GBPRegular priceSale price £142.25 GBP -
Topiroxostat (Standard) [CAS 577778-58-6]
CAS: 577778-58-6 | SKU: QM-0110321-01 | Size: 5 mgRegular price £127.38 GBPRegular priceSale price £127.38 GBP -
Topoisomerase II/EGFR-IN-1
SKU: QM-0072920 | Size: 1 Each Price on request -
Tumor targeted pro-apoptotic peptide [CAS 1926163-30-5]
CAS: 1926163-30-5 | SKU: QM-0106903 | Size: 1 Each Price on request -
Thailanstatin A cyclohexane diamine (formic)
SKU: QM-0105869 | Size: 1 mgRegular price £1,179.95 GBPRegular priceSale price £1,179.95 GBP -
Vat-Cit-PAB-Monomethyl Dolastatin 10 [CAS 1415329-13-3]
CAS: 1415329-13-3 | SKU: QM-0000394-01 | Size: 1 mgRegular price £279.63 GBPRegular priceSale price £279.63 GBP -
TOPOI/PARP-1-IN-1 [CAS 2948352-16-5]
CAS: 2948352-16-5 | SKU: QM-0105582 | Size: 1 Each Price on request -
Top/HDAC-IN-3 [CAS 3059615-90-3]
CAS: 3059615-90-3 | SKU: QM-0104738 | Size: 1 Each Price on request -
VEGFR-2, Human (1355a.a, sf9, GST)
SKU: QM-0102023 | Size: 1 Each Price on request -
Topo II/HDAC-IN-1 [CAS 2922269-18-7]
CAS: 2922269-18-7 | SKU: QM-0068214 | Size: 1 Each Price on request -
VEGF165, zebrafish (sf9)
SKU: QM-0113305 | Size: Inquire Price on request -
VEGFR-1, Human (328a.a, HEK293, Fc)
SKU: QM-0097219 | Size: 1 Each Price on request -
Tubulin/HDAC-IN-1 [CAS 2413587-26-3]
CAS: 2413587-26-3 | SKU: QM-0069063 | Size: 1 Each Price on request -
Tubulin/PARP-IN-1
SKU: QM-0072756 | Size: 1 Each Price on request -
TLR4/NF-κB/MAPK-IN-1 [CAS 2767567-26-8]
CAS: 2767567-26-8 | SKU: QM-0065134 | Size: 1 Each Price on request -
TIPARP Human Pre-designed siRNA Set A
SKU: QM-0090066 | Size: 1 SetRegular price £426.65 GBPRegular priceSale price £426.65 GBP -
Tyrosine Protein Kinase JAK 2 (Phospho-Tyr8, 9) [CAS 247171-44-4]
CAS: 247171-44-4 | SKU: QM-0001273 | Size: 1 Each Price on request -
Type A Allatostatin III [CAS 123209-96-1]
CAS: 123209-96-1 | SKU: QM-0089147 | Size: 1 Each Price on request -
Tie2 kinase inhibitor 3 [CAS 870225-11-9]
CAS: 870225-11-9 | SKU: QM-0087613 | Size: 1 Each Price on request -
VEGFR-2, Cynomolgus (Biotinylated, HEK293, His, Avi)
SKU: QM-0087142 | Size: 1 Each Price on request -
Tubulin/PARP-IN-2
SKU: QM-0072860 | Size: 1 Each Price on request -
Thrombostatin cont-1 [CAS 929555-19-1]
CAS: 929555-19-1 | SKU: QM-0085763 | Size: 1 Each Price on request -
Thailanstatin C [CAS 1426953-24-3]
CAS: 1426953-24-3 | SKU: QM-0063644 | Size: 1 Each Price on request -
Tyr-Somatostatin-28 [CAS 86649-84-5]
CAS: 86649-84-5 | SKU: QM-0084554 | Size: 1 Each Price on request -
Tubastatin A (TFA) [CAS 1239262-52-2]
CAS: 1239262-52-2 | SKU: QM-0061979 | Size: 1 Each Price on request -
Tubulin/HDAC-IN-2
SKU: QM-0071874 | Size: 1 Each Price on request -
STAT6-IN-7 [CAS 3033743-58-4]
CAS: 3033743-58-4 | SKU: QM-0050536 | Size: 1 Each Price on request -
STAT6-IN-8 [CAS 3033741-50-0]
CAS: 3033741-50-0 | SKU: QM-0050535 | Size: 1 Each Price on request -
Stat5a Rat Pre-designed siRNA Set A
SKU: QM-0043495 | Size: 1 SetRegular price £426.65 GBPRegular priceSale price £426.65 GBP -
Stath Rat Pre-designed siRNA Set A
SKU: QM-0042395 | Size: 1 SetRegular price £426.65 GBPRegular priceSale price £426.65 GBP -
Stat4 Rat Pre-designed siRNA Set A
SKU: QM-0041525 | Size: 1 SetRegular price £426.65 GBPRegular priceSale price £426.65 GBP -
Stat5a Mouse Pre-designed siRNA Set A
SKU: QM-0037010 | Size: 1 SetRegular price £426.65 GBPRegular priceSale price £426.65 GBP -
Stat4 Mouse Pre-designed siRNA Set A
SKU: QM-0035082 | Size: 1 SetRegular price £426.65 GBPRegular priceSale price £426.65 GBP -
STAT6 ligand-2
SKU: QM-0016378 | Size: 1 Each Price on request -
STAT3-IN-49
SKU: QM-0016040 | Size: 1 Each Price on request -
Tenivastatin (calcium) [CAS 151006-18-7]
CAS: 151006-18-7 | SKU: QM-0015106 | Size: 1 Each Price on request -
STAT3-IN-47 [CAS 2787548-58-5]
CAS: 2787548-58-5 | SKU: QM-0015015 | Size: 1 Each Price on request -
STAT3-IN-52 [CAS 1556861-34-7]
CAS: 1556861-34-7 | SKU: QM-0014908-01 | Size: 5 mgRegular price £285.71 GBPRegular priceSale price £285.71 GBP -
STAT6 degrader-3 [CAS 3077464-19-5]
CAS: 3077464-19-5 | SKU: QM-0014525-01 | Size: 1 mgRegular price £678.15 GBPRegular priceSale price £678.15 GBP -
Suvigletistat [CAS 2410912-75-1]
CAS: 2410912-75-1 | SKU: QM-0014390-01 | Size: 5 mgRegular price £1,368.28 GBPRegular priceSale price £1,368.28 GBP -
STAT6-IN-10 [CAS 3092076-19-9]
CAS: 3092076-19-9 | SKU: QM-0014274 | Size: 1 Each Price on request -
STAT6 ligand-1
SKU: QM-0014202 | Size: 1 Each Price on request -
STAT3-IN-46
SKU: QM-0013412 | Size: 1 Each Price on request -
STAT6-IN-9 [CAS 3092076-15-5]
CAS: 3092076-15-5 | SKU: QM-0013317 | Size: 1 Each Price on request -
STAT3/NF-κB-IN-1
SKU: QM-0012956 | Size: 1 Each Price on request -
STAT3-IN-44
SKU: QM-0012762 | Size: 1 Each Price on request -
STAT3/CAIX-IN-1 [CAS 3053583-60-8]
CAS: 3053583-60-8 | SKU: QM-0012048 | Size: 1 Each Price on request -
STAT3-IN-43 [CAS 2761657-21-8]
CAS: 2761657-21-8 | SKU: QM-0011972 | Size: 1 Each Price on request -
STAT4-IN-1
SKU: QM-0011334-01 | Size: 5 mgRegular price £828.82 GBPRegular priceSale price £828.82 GBP -
STAT3-IN-40 [CAS 3053241-01-0]
CAS: 3053241-01-0 | SKU: QM-0011123 | Size: 1 Each Price on request -
STAT3-IN-42
SKU: QM-0011083 | Size: 1 Each Price on request -
STAT5-IN-3
SKU: QM-0009637 | Size: 1 Each Price on request -
STAT3-IN-41
SKU: QM-0008680 | Size: 1 Each Price on request -
Stattic (Standard) [CAS 19983-44-9]
CAS: 19983-44-9 | SKU: QM-0006619-01 | Size: 5 mgRegular price £111.63 GBPRegular priceSale price £111.63 GBP -
Telaglenastat (Standard) [CAS 1439399-58-2]
CAS: 1439399-58-2 | SKU: QM-0004844-01 | Size: 5 mgRegular price £238.32 GBPRegular priceSale price £238.32 GBP -
Statine (Standard) [CAS 49642-07-1]
CAS: 49642-07-1 | SKU: QM-0002508 | Size: 1 Each Price on request -
Subasumstat [CAS 1858276-04-6]
CAS: 1858276-04-6 | SKU: QM-0137215-01 | Size: 1 mgRegular price £135.25 GBPRegular priceSale price £135.25 GBP -
Telaglenastat [CAS 1439399-58-2]
CAS: 1439399-58-2 | SKU: QM-0140548-01 | Size: 5 mgRegular price £94.75 GBPRegular priceSale price £94.75 GBP -
STAT5-IN-2 [CAS 2111834-61-6]
CAS: 2111834-61-6 | SKU: QM-0081781-01 | Size: 5 mgRegular price £551.80 GBPRegular priceSale price £551.80 GBP -
Telotristat [CAS 1033805-28-5]
CAS: 1033805-28-5 | SKU: QM-0143300-01 | Size: 5 mgRegular price £124.00 GBPRegular priceSale price £124.00 GBP -
STAT6-IN-3 [CAS 371919-80-1]
CAS: 371919-80-1 | SKU: QM-0077582-01 | Size: 1 mgRegular price £865.26 GBPRegular priceSale price £865.26 GBP -
Tazemetostat [CAS 1403254-99-8]
CAS: 1403254-99-8 | SKU: QM-0146166-01 | Size: 5 mgRegular price £94.75 GBPRegular priceSale price £94.75 GBP -
STAT5-IN-1 [CAS 285986-31-4]
CAS: 285986-31-4 | SKU: QM-0081601-01 | Size: 5 mgRegular price £94.75 GBPRegular priceSale price £94.75 GBP -
Sucunamostat (hydrochloride)
SKU: QM-0144177-01 | Size: 5 mgRegular price £890.78 GBPRegular priceSale price £890.78 GBP -
Stattic [CAS 19983-44-9]
CAS: 19983-44-9 | SKU: QM-0146214-01 | Size: 5 mgRegular price £65.37 GBPRegular priceSale price £65.37 GBP -
Tazemetostat de (methyl morpholine) -COOH [CAS 2685873-44-1]
CAS: 2685873-44-1 | SKU: QM-0149222-01 | Size: 5 mgRegular price £551.80 GBPRegular priceSale price £551.80 GBP -
STAT6-IN-2 [CAS 1355594-85-2]
CAS: 1355594-85-2 | SKU: QM-0151384-01 | Size: 5 mgRegular price £325.81 GBPRegular priceSale price £325.81 GBP -
STAT6-IN-1 [CAS 1637532-68-3]
CAS: 1637532-68-3 | SKU: QM-0149554-01 | Size: 5 mgRegular price £1,013.50 GBPRegular priceSale price £1,013.50 GBP -
STAT3-IN-48 [CAS 1313019-65-6]
CAS: 1313019-65-6 | SKU: QM-0145696-01 | Size: 5 mgRegular price £140.88 GBPRegular priceSale price £140.88 GBP -
Tazemetostat (Standard) [CAS 1403254-99-8]
CAS: 1403254-99-8 | SKU: QM-0146167-01 | Size: 5 mgRegular price £238.32 GBPRegular priceSale price £238.32 GBP -
Telotristat ethyl [CAS 1033805-22-9]
CAS: 1033805-22-9 | SKU: QM-0143299-01 | Size: 5 mgRegular price £135.25 GBPRegular priceSale price £135.25 GBP -
Tazemetostat de (methylene morpholine) -O-C3-O-C-COOH [CAS 2750350-39-9]
CAS: 2750350-39-9 | SKU: QM-0149221-01 | Size: 5 mgRegular price £614.98 GBPRegular priceSale price £614.98 GBP -
STAT3-SH2 domain inhibitor 1 [CAS 2816059-41-1]
CAS: 2816059-41-1 | SKU: QM-0150575-01 | Size: 5 mgRegular price £765.63 GBPRegular priceSale price £765.63 GBP -
Tefinostat [CAS 914382-60-8]
CAS: 914382-60-8 | SKU: QM-0112177-01 | Size: 5 mgRegular price £414.50 GBPRegular priceSale price £414.50 GBP -
Stathmin, Human (His)
SKU: QM-0204675-01 | Size: 5 µgRegular price £97.00 GBPRegular priceSale price £97.00 GBP -
TAO Kinase inhibitor 1 [CAS 850467-66-2]
CAS: 850467-66-2 | SKU: QM-0137356-01 | Size: 5 mgRegular price £118.38 GBPRegular priceSale price £118.38 GBP -
Telotristat etiprate [CAS 1137608-69-5]
CAS: 1137608-69-5 | SKU: QM-0143295-01 | Size: 5 mgRegular price £115.00 GBPRegular priceSale price £115.00 GBP -
STAT6, Human (His)
SKU: QM-0204404-01 | Size: 5 µgRegular price £111.63 GBPRegular priceSale price £111.63 GBP -
STAT6-IN-5 [CAS 3033742-22-9]
CAS: 3033742-22-9 | SKU: QM-0152565-01 | Size: 1 mgRegular price £865.26 GBPRegular priceSale price £865.26 GBP -
STAT4, Human (sf9, His)
SKU: QM-0204228-01 | Size: 5 µgRegular price £132.13 GBPRegular priceSale price £132.13 GBP -
Talabostat (mesylate) [CAS 150080-09-4]
CAS: 150080-09-4 | SKU: QM-0143965-01 | Size: 5 mgRegular price £215.24 GBPRegular priceSale price £215.24 GBP -
STAT6-IN-4 [CAS 3033742-14-9]
CAS: 3033742-14-9 | SKU: QM-0152564-01 | Size: 1 mgRegular price £727.97 GBPRegular priceSale price £727.97 GBP -
STAT6, Human (536a.a, His)
SKU: QM-0202715-01 | Size: 5 µgRegular price £280.34 GBPRegular priceSale price £280.34 GBP -
Statherin, Human (HEK293, Fc)
SKU: QM-0202556-01 | Size: 5 µgRegular price £101.75 GBPRegular priceSale price £101.75 GBP -
Synstatin (92-119) [CAS 1259384-47-8]
CAS: 1259384-47-8 | SKU: QM-0196417-01 | Size: 1 mgRegular price £78.82 GBPRegular priceSale price £78.82 GBP -
TAT-Braftide
SKU: QM-0195494-01 | Size: 1 mgRegular price £89.13 GBPRegular priceSale price £89.13 GBP -
Talabostat isomer mesylate
SKU: QM-0143966-01 | Size: 5 mgRegular price £376.83 GBPRegular priceSale price £376.83 GBP -
Stathmin, Human (C-His)
SKU: QM-0184589-01 | Size: 10 µgRegular price £127.38 GBPRegular priceSale price £127.38 GBP -
Statine [CAS 49642-07-1]
CAS: 49642-07-1 | SKU: QM-0081625-01 | Size: 5 mgRegular price £188.51 GBPRegular priceSale price £188.51 GBP -
TAO Kinase inhibitor 2 [CAS 850467-77-5]
CAS: 850467-77-5 | SKU: QM-0151280-01 | Size: 5 mgRegular price £124.00 GBPRegular priceSale price £124.00 GBP -
STAT6, Human (sf9, His, Strep)
SKU: QM-0176080-01 | Size: 10 µgRegular price £324.07 GBPRegular priceSale price £324.07 GBP -
STAT6, Human (Phosphorylated, 536a.a, His)
SKU: QM-0175581-01 | Size: 10 µgRegular price £1,181.87 GBPRegular priceSale price £1,181.87 GBP -
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
SKU: QM-0172917-01 | Size: 5 mgRegular price £715.82 GBPRegular priceSale price £715.82 GBP -
STAT5B, Human (His)
SKU: QM-0172228-01 | Size: 10 µgRegular price £241.46 GBPRegular priceSale price £241.46 GBP -
Talabostat [CAS 149682-77-9]
CAS: 149682-77-9 | SKU: QM-0000457-01 | Size: 5 mgRegular price £215.24 GBPRegular priceSale price £215.24 GBP -
STAT5B Human Pre-designed siRNA Set A
SKU: QM-0167628 | Size: 1 SetRegular price £426.65 GBPRegular priceSale price £426.65 GBP -
Stearyl myristate [CAS 3234-81-9]
CAS: 3234-81-9 | SKU: QM-0135828 | Size: 1 Each Price on request -
STAT6 Human Pre-designed siRNA Set A
SKU: QM-0132904 | Size: 1 SetRegular price £426.65 GBPRegular priceSale price £426.65 GBP -
TCO-PAL-PARP
SKU: QM-0132692 | Size: 1 Each Price on request -
STAT3/HDAC-IN-2
SKU: QM-0126394 | Size: 1 Each Price on request -
Telaglenastat (hydrochloride) [CAS 1874231-60-3]
CAS: 1874231-60-3 | SKU: QM-0060224 | Size: 1 Each Price on request -
TAT-MEK1 [CAS 566872-16-0]
CAS: 566872-16-0 | SKU: QM-0124321 | Size: 1 Each Price on request -
Stat5b Rat Pre-designed siRNA Set A
SKU: QM-0124224 | Size: 1 SetRegular price £426.65 GBPRegular priceSale price £426.65 GBP -
STATH Human Pre-designed siRNA Set A
SKU: QM-0122701 | Size: 1 SetRegular price £426.65 GBPRegular priceSale price £426.65 GBP -
Telotristat (besilate) [CAS 1374745-52-4]
CAS: 1374745-52-4 | SKU: QM-0119808 | Size: 1 Each Price on request -
Tanomastat [CAS 179545-77-8]
CAS: 179545-77-8 | SKU: QM-0060095 | Size: 500 µgRegular price £125.13 GBPRegular priceSale price £125.13 GBP -
Telotristat (Standard) [CAS 1033805-28-5]
CAS: 1033805-28-5 | SKU: QM-0115948-01 | Size: 5 mgRegular price £325.81 GBPRegular priceSale price £325.81 GBP -
STAT5A Protein, Human (sf9, His)
SKU: QM-0115614-01 | Size: 100 µg Price on request -
Stat6 Rat Pre-designed siRNA Set A
SKU: QM-0113783 | Size: 1 SetRegular price £426.65 GBPRegular priceSale price £426.65 GBP -
STAT3/AKT-IN-1
SKU: QM-0111268 | Size: 1 Each Price on request -
SYK/JAK-IN-1 [CAS 2737326-28-0]
CAS: 2737326-28-0 | SKU: QM-0066078 | Size: 1 Each Price on request -
Symplostatin 1 [CAS 212007-18-6]
CAS: 212007-18-6 | SKU: QM-0108890 | Size: 1 Each Price on request -
Sucunamostat [CAS 1802888-04-5]
CAS: 1802888-04-5 | SKU: QM-0061994 | Size: 1 Each Price on request -
Sucunamostat (hydrate)
SKU: QM-0061361 | Size: 1 Each Price on request -
STAT3-IN-7 [CAS 2237955-91-6]
CAS: 2237955-91-6 | SKU: QM-0066046 | Size: 1 Each Price on request -
STE-MEK1 (13) [CAS 566872-15-9]
CAS: 566872-15-9 | SKU: QM-0096254 | Size: 1 Each Price on request